PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000195385
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 509aa    MW: 56479.7 Da    PI: 7.2174
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000195385genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.41.4e-33211268260
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    dDg+nWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d+++++i+Y+g+Hnh+k
  MDP0000195385 211 DDGFNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSL-DGQITQIVYKGNHNHPK 268
                    8****************************************.***************85 PP

2WRKY106.81.1e-33375433159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vkg+++prsYY+Cts gCpv+k+ver+++d+++v++tYeg+Hnh+
  MDP0000195385 375 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSVGCPVRKHVERASQDTRAVITTYEGKHNHD 433
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.7E-28203269IPR003657WRKY domain
PROSITE profilePS5081123.915205269IPR003657WRKY domain
SuperFamilySSF1182903.79E-25208269IPR003657WRKY domain
SMARTSM007741.9E-36210268IPR003657WRKY domain
PfamPF031062.3E-25211267IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.7E-37360435IPR003657WRKY domain
SuperFamilySSF1182902.35E-29367435IPR003657WRKY domain
PROSITE profilePS5081138.538370435IPR003657WRKY domain
SMARTSM007743.2E-39375434IPR003657WRKY domain
PfamPF031067.9E-26376433IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MTSSFTHLLT SNMENSGIGQ DRTNWGGLFS DYSSNPNRFV DRNGTDIPKF KSLQPPSLPL  60
SPPPVSPSSY LTSTPAFSPT DFLSSPMFLS SSYNLESPTT GSFSSQVFDW MNNTKDTQQG  120
IKDKEEPKLF SDFSFQPESR PATNLQSSSS MEEPFKGERQ AWDFSAEKTG VKSEFEPIEA  180
NTQSNGLNGA PKSDYLHSNQ CSQYAREQKS DDGFNWRKYG QKQVKGSENP RSYYKCTFPN  240
CPTKKKVERS LDGQITQIVY KGNHNHPKPQ STRRSSSNSI QGSFYGISDQ SVPTLSNPKV  300
ESVSLQEDSS TSIGEDEFEQ NSPISNSVGA EDENEPEAKR WKGDNANDQS YASSGGRIVK  360
EPRIVVQTTS EIDILDDGYR WRKYGQKVVK GNPNPRSYYK CTSVGCPVRK HVERASQDTR  420
AVITTYEGKH NHDVPAARGS GNYSNASRPA ADNNSNNVSM AVRPLPLPNH SNLSYLNSLQ  480
NARQPATTES QPPYTLKMQS AGSYGFSEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-37211436878Probable WRKY transcription factor 4
2lex_A1e-37211436878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.158840.0fruit| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008388871.10.0PREDICTED: probable WRKY transcription factor 33
SwissprotQ8S8P51e-119WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLD9ZJG30.0D9ZJG3_MALDO; WRKY domain class transcription factor
STRINGPOPTR_0016s13600.11e-164(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF107734114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-117WRKY DNA-binding protein 33